Leptosomus discolor (cuckoo roller): 104350975 Help Entry 104350975         CDS       T08399                                  Name (RefSeq) fibroblast growth factor 5-like   KO K04358   fibroblast growth factor Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04010   MAPK signaling pathway ldi04020   Calcium signaling pathway ldi04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ldi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104350975    04020 Calcium signaling pathway     104350975  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104350975  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ldi04052]     104350975    00536 Glycosaminoglycan binding proteins [BR:ldi00536]     104350975 Cytokines and neuropeptides [BR:ldi04052]  Cytokines   Growth factors (RTK binding)    104350975 Glycosaminoglycan binding proteins [BR:ldi00536]  Heparan sulfate / Heparin   Growth factors/receptors    104350975 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  104350975 NCBI-ProteinID:  XP_009955253 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search ARFTADCQFRERFQENSYNTYASAIHRSPRSGRQWYVALNKRGKAKRGCSPRARPQHVST HFLPRFRQPQPPELAFTVTLPEKKPPPPPKPKVASSPPWKNPSPVKYRLKFRFG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt gcccggttcacggcagactgccagtttcgggagcgcttccaggagaacagctacaacacc tacgcctcggccatccaccgcagcccacgctcaggccgccagtggtacgtggctctcaac aagcggggcaaagccaagcggggctgcagcccccgtgcccggccccagcacgtctccacg cacttcctcccccgctttcggcagccccagcccccggagctcgccttcactgtcaccctc cctgaaaagaagcccccaccaccaccaaaaccaaaggttgcctcatccccaccttggaaa aaccccagccccgtcaagtaccgtctgaagtttcgctttgggtag

DBGET integrated database retrieval system