Leptosomus discolor (cuckoo roller): 104351733 Help Entry 104351733         CDS       T08399                                  Name (RefSeq) transcription factor HES-1-like   KO K06054   hairy and enhancer of split 1 Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi03460   Fanconi anemia pathway ldi04330   Notch signaling pathway Brite KEGG Orthology (KO) [BR:ldi00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     104351733  09130 Environmental Information Processing   09132 Signal transduction    04330 Notch signaling pathway     104351733  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ldi03000]     104351733    03400 DNA repair and recombination proteins [BR:ldi03400]     104351733 Transcription factors [BR:ldi03000]  Eukaryotic type   Basic helix-loop-helix (bHLH)    Hairy, Hairy/E(SPL)     104351733 DNA repair and recombination proteins [BR:ldi03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      104351733 SSDB OrthologParalogGFIT Motif Pfam:  Hairy_orange Motif Other DBs NCBI-GeneID:  104351733 NCBI-ProteinID:  XP_009956200 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search SLLTAVRLSPPTAALSTDPTVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLAS CMTQINAMNYPAPPPPPPKVYGGFQLLPASDGQFAFLIPSTAFAPGGAVLPLYGGPPTAA TAASPPGPPPGTADSVWRPW NT seq 423 nt NT seq  +upstreamnt  +downstreamnt agcctgctgactgctgtgcgcctctctccccccacagccgcactgagcacagaccccacg gtgctgggcaagtaccgcgccggcttcagcgagtgcatgaacgaggtgacacggttcctc tccacctgcgagggcgtcaacaccgaggtgcgcacccggctcctgggccacctggccagc tgcatgacccagatcaacgccatgaactaccccgcgccccccccaccgccccccaaggtg tacggtggcttccagctgctgccggcttccgatgggcaatttgccttcctcatccccagc accgcctttgctcctggcggtgctgtgctgcccctgtatggtggcccacccacggctgcc actgctgcctcgccgcctggcccgccacccggcacggctgactcagtctggagaccctgg tga

DBGET integrated database retrieval system