Leptosomus discolor (cuckoo roller): 104351888 Help Entry 104351888         CDS       T08399                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04621   NOD-like receptor signaling pathway ldi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ldi00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104351888 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104351888 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ldi03110]     104351888 (TXN) Chaperones and folding catalysts [BR:ldi03110]  Protein folding catalysts   Protein disulfide isomerase    104351888 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 DIM1 Redoxin Glutaredoxin Motif Other DBs NCBI-GeneID:  104351888 NCBI-ProteinID:  XP_009956390 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search SEFESELKSAGEKLIVVDFSAAWCGPCRIIKPFFHSLSEKYGDVVFIEIDVDDAQDVATH CDVKCMPTFQFYKNGQKVEEFSGANKEKLEETIKSLV NT seq 294 nt NT seq  +upstreamnt  +downstreamnt tctgaatttgagtcagaactgaaatctgctggagagaagcttatagtagttgatttctct gctgcatggtgtggaccatgcagaattatcaagccctttttccacagtttgagtgagaag tatggtgatgtggtgttcatcgaaattgatgtggatgatgcccaggacgttgctacacac tgtgatgtgaaatgcatgcccacattccagttctataagaatggacagaaggtggaggag ttctctggggccaataaagagaagctggaagagaccattaaaagtctagtctaa

DBGET integrated database retrieval system