Leptosomus discolor (cuckoo roller): 104352187 Help Entry 104352187         CDS       T08399                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism ldi  Leptosomus discolor (cuckoo roller) Brite KEGG Orthology (KO) [BR:ldi00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ldi01002]     104352187 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ldi04147]     104352187 (CSTB) Peptidases and inhibitors [BR:ldi01002]  Peptidase inhibitors   Family I25: cystatin family    104352187 (CSTB) Exosome [BR:ldi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104352187 (CSTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin SQAPI Dynein_light AAA_lid_NAV1 Motif Other DBs NCBI-GeneID:  104352187 NCBI-ProteinID:  XP_009956762 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search VKPQLEEKEGKTFDVFTAVEFKTQVVAGTNYFIKVHVGNDEFMHLRVFRSLPHESKPLSL HSYQSSKAKHDELAFF NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgaaacctcagctagaagaaaaagaagggaaaacgtttgatgtcttcactgcagtggag tttaaaactcaggtggttgctggaacaaactacttcatcaaggtccatgttggcaatgat gagttcatgcacctgcgggtgttcagaagccttcctcacgagagtaagccgctgagtctc cacagttaccagagcagcaaggctaagcatgatgaactggcttttttctag

DBGET integrated database retrieval system