Leptosomus discolor (cuckoo roller): 104352313 Help Entry 104352313         CDS       T08399                                  Symbol PROK1 Name (RefSeq) prokineticin-1   KO K24191   prokineticin Organism ldi  Leptosomus discolor (cuckoo roller) Brite KEGG Orthology (KO) [BR:ldi00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ldi04052]     104352313 (PROK1) Cytokines and neuropeptides [BR:ldi04052]  Cytokines   Chemokines    104352313 (PROK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prokineticin Motif Other DBs NCBI-GeneID:  104352313 NCBI-ProteinID:  XP_009956918 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MGRLLQTLCLLLLISSCPCAVITGCTPLGQEGDECHPFSHKVPFFGKRQHHTCPCLPNFM CSRFLDGRYRCSVNFKNIDFLG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgggccggctcctgcaaaccctctgcttgctcctgctcatctcctcctgcccctgcgcc gtcatcaccgggtgcacccccctggggcaggagggggacgaatgccaccccttcagtcac aaggttcctttcttcgggaagcgccagcaccacacctgcccgtgtttgcccaacttcatg tgctccaggttcctcgacggccgctaccgctgctccgtcaacttcaagaacattgatttt ttagggtga

DBGET integrated database retrieval system