Leptosomus discolor (cuckoo roller): 104353561 Help Entry 104353561         CDS       T08399                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04060   Cytokine-cytokine receptor interaction ldi04218   Cellular senescence ldi04620   Toll-like receptor signaling pathway ldi04621   NOD-like receptor signaling pathway ldi04622   RIG-I-like receptor signaling pathway ldi05132   Salmonella infection ldi05164   Influenza A Brite KEGG Orthology (KO) [BR:ldi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104353561  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104353561  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104353561    04621 NOD-like receptor signaling pathway     104353561    04622 RIG-I-like receptor signaling pathway     104353561  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104353561   09171 Infectious disease: bacterial    05132 Salmonella infection     104353561  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ldi04052]     104353561    00536 Glycosaminoglycan binding proteins [BR:ldi00536]     104353561 Cytokines and neuropeptides [BR:ldi04052]  Cytokines   Chemokines    104353561 Glycosaminoglycan binding proteins [BR:ldi00536]  Heparan sulfate / Heparin   Chemokines    104353561 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104353561 NCBI-ProteinID:  XP_009958476 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MTGKALAAVLTLLLISAVGTKGKALPRSAIELRCQCIGTHSKFIHPKFIHNVNLIPSGPH CKNVEVIATLTDGREVCLEPTAPWVKLIIKAILDKANTKPETVS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgacgggcaaggctctggctgctgtcctgactcttctcctgatctcagcggttggaaca aaaggtaaggccctgccacgctcagcgattgaactgcggtgccagtgcataggcacccat tccaagttcatccaccccaagttcattcataacgtgaacctcatccccagtggacctcac tgcaagaatgttgaagtcatagctaccctgacagacggcagagaagtgtgcctggagccc actgctccctgggtgaagctgatcatcaaggcaattctggacaaggcaaacaccaaacct gagacagtgtcctaa

DBGET integrated database retrieval system