Leptosomus discolor (cuckoo roller): 104353612 Help Entry 104353612         CDS       T08399                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi03272   Virion - Hepatitis viruses ldi04382   Cornified envelope formation ldi04514   Cell adhesion molecule (CAM) interaction ldi04530   Tight junction Brite KEGG Orthology (KO) [BR:ldi00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104353612  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104353612  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104353612  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104353612  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ldi03037]     104353612    04147 Exosome [BR:ldi04147]     104353612 Cilium and associated proteins [BR:ldi03037]  Other cilia and associated proteins   Stereociliary proteins    104353612 Exosome [BR:ldi04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104353612   Exosomal proteins of colorectal cancer cells    104353612 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF7544 DUF1218 DUF1634 DUF7937 EI24 DUF7541 Motif Other DBs NCBI-GeneID:  104353612 NCBI-ProteinID:  XP_009958536 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search PQDLQAARAMVVVAIVLAVLGTLLAVAGGKCTNCVEDDTAKAKVMILSGIIFIVAGILIL IPVSLSANTIIRDFYNPLVTDSQKRDLGSSLYVGWAASALLLLGGGILCCTCPPRGEKPY SAKFTA NT seq 378 nt NT seq  +upstreamnt  +downstreamnt ccgcaggacctgcaagccgcccgcgccatggtggtggtggccatcgtcttggccgtcctt ggcaccctgctcgccgtcgccggcggcaagtgcaccaactgcgtggaggatgacaccgcc aaagccaaggtcatgatcctctccggcatcattttcatcgtcgccggcatcctcatcctc atccccgtctctttgtcggccaacaccatcatccgggacttctacaacccgctggtcacc gactcccagaagagggacctggggtcgtccctctacgtgggctgggcggcctccgcgctc ctgctgctggggggggggatcctctgctgcacctgccccccccggggcgagaagccctac tctgccaaattcacggcc

DBGET integrated database retrieval system