Leptosomus discolor (cuckoo roller): 104354754 Help Entry 104354754         CDS       T08399                                  Name (RefSeq) lysozyme-like protein 1   KO K25707   lysozyme [EC:3.2.1.17] Organism ldi  Leptosomus discolor (cuckoo roller) Brite KEGG Orthology (KO) [BR:ldi00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ldi03037]     104354754 Enzymes [BR:ldi01000]  3. Hydrolases   3.2  Glycosylases    3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds     3.2.1.17  lysozyme      104354754 Cilium and associated proteins [BR:ldi03037]  Motile cilia and associated proteins   Sperm associated proteins    104354754 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lys SLT Toxin_6 Motif Other DBs NCBI-GeneID:  104354754 NCBI-ProteinID:  XP_009960062 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MAFCESIFNTAAQSIKAGGSTDYGIFQISSQLWCTDHCSPSDNHCRMAHRDLLSSNITDD IICAKRIVRNPQGMNVWEGCAMHCKGQDLSEWVEGCDL NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggccttttgcgagagcatcttcaacacagcagctcagagcatcaaagcaggcggcagc actgactacggaatcttccagatcagcagccagctgtggtgcaccgaccactgcagcccc tcggataaccactgcaggatggctcacagggatctgctatcgagtaacataactgatgac atcatctgtgccaaaagaattgtgagaaacccacaaggaatgaatgtctgggagggctgc gctatgcactgcaagggacaagacctgtctgagtgggtggaaggatgtgacctgtga

DBGET integrated database retrieval system