Leishmania donovani: LDBPK_010160 Help Entry LDBPK_010160      CDS       T02289                                  Name (RefSeq) hypothetical protein   KO K12625   U6 snRNA-associated Sm-like protein LSm6 Organism ldo  Leishmania donovani Pathway ldo03018   RNA degradation ldo03040   Spliceosome Brite KEGG Orthology (KO) [BR:ldo00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     LDBPK_010160   09123 Folding, sorting and degradation    03018 RNA degradation     LDBPK_010160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ldo03019]     LDBPK_010160    03041 Spliceosome [BR:ldo03041]     LDBPK_010160 Messenger RNA biogenesis [BR:ldo03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      LDBPK_010160   mRNA degradation factors    5'-3' decay     Lsm complex      LDBPK_010160 Spliceosome [BR:ldo03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     LDBPK_010160 SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  13389723 NCBI-ProteinID:  XP_003857829 UniProt:  A0A451EJ73 LinkDB All DBs Position 1:complement(39627..39869) Genome browser AA seq 80 aa AA seqDB search MSVALESLLHRSVCCHLAHGEEYRGQLEALDGTFDVVLSQCTRSRAAPRQPAEPLVFLRG ENIIYIGFDESSRSEDGTTA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtccgttgccttggagtcgcttctgcaccgatccgtgtgctgccacctggcacacggt gaggagtaccgaggccagctggaggccctggacggcaccttcgatgtggtcctgtcgcag tgcacgcggagccgcgccgccccaaggcagccggccgagcccctcgtttttctgcgcggc gagaacatcatctacatcggcttcgacgagtcgtccagaagtgaggacgggaccaccgcg tga

DBGET integrated database retrieval system