Leishmania donovani: LDBPK_210620 Help Entry LDBPK_210620      CDS       T02289                                  Name (RefSeq) hypothetical protein   KO K08499   member of the syntaxin family of t-SNAREs Organism ldo  Leishmania donovani Pathway ldo04130   SNARE interactions in vesicular transport Brite KEGG Orthology (KO) [BR:ldo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04130 SNARE interactions in vesicular transport     LDBPK_210620  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ldo04131]     LDBPK_210620 Membrane trafficking [BR:ldo04131]  SNARE   SNAP-25[C] (Qc)    STX6     LDBPK_210620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CadC_C1 Motif Other DBs NCBI-GeneID:  13386394 NCBI-ProteinID:  XP_003860579 UniProt:  A0A3S7WWG9 LinkDB All DBs Position 21:complement(174906..175196) Genome browser AA seq 96 aa AA seqDB search MERTFAQQDDLRTQDQLLDQLHASVMNTRHYAIQIGNDLGEQDDMLDRLHGNVTRTADES RRQNQNVIQLLRESENRGFYSVVLLLVVIIILLLAI NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggagcgcacctttgcccagcaggatgacttgcgcacgcaggatcagctgctcgatcag ctgcacgcctctgtgatgaacacgcgacactacgcgattcagatcggcaacgacctcggc gaacaggacgacatgctggaccgtctgcatggcaatgtgacccgcacagcagacgagagt cggcggcagaaccagaacgtcatccaactgctcagggagagcgagaatcgcgggttctac tccgttgtgctgctcctagtcgtcatcatcatactactgctggccatttga

DBGET integrated database retrieval system