Leishmania donovani: LDBPK_260010 Help Entry LDBPK_260010      CDS       T02289                                  Name (RefSeq) Lsm7p protein, putative   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism ldo  Leishmania donovani Pathway ldo03018   RNA degradation ldo03040   Spliceosome Brite KEGG Orthology (KO) [BR:ldo00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     LDBPK_260010   09123 Folding, sorting and degradation    03018 RNA degradation     LDBPK_260010  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ldo03019]     LDBPK_260010    03041 Spliceosome [BR:ldo03041]     LDBPK_260010 Messenger RNA biogenesis [BR:ldo03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      LDBPK_260010   mRNA degradation factors    5'-3' decay     Lsm complex      LDBPK_260010 Spliceosome [BR:ldo03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     LDBPK_260010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  13389116 NCBI-ProteinID:  XP_003861589 UniProt:  A0A3Q8ICP6 LinkDB All DBs Position 26:complement(1232..1507) Genome browser AA seq 91 aa AA seqDB search MSAEAAHILKKKEGILSLEKYLDRKVVVSQKNHEVHGVLKGFDNNVNLVLADAELWHRNT HIRKIGACVVRGGPVNLILSGDTTIIPNPFI NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtccgcggaggcggcacacatactgaaaaaaaaggagggcattctgtccttggaaaag taccttgatcgtaaggtagtggtatcgcaaaaaaaccatgaagtgcacggcgtactgaaa gggtttgacaataatgtgaacttggttctagccgacgcagagttgtggcaccgcaacaca cacatacgcaagattggcgcctgtgtcgtgcgtggtggccccgtaaacctcatcctttcc ggtgacaccaccatcattccaaatccctttatttag

DBGET integrated database retrieval system