Leishmania donovani: LDBPK_344170 Help Entry LDBPK_344170      CDS       T02289                                  Name (RefSeq) hypothetical protein   KO K16780   sjoegren syndrome nuclear autoantigen 1 Organism ldo  Leishmania donovani Brite KEGG Orthology (KO) [BR:ldo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ldo03036]     LDBPK_344170   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ldo03037]     LDBPK_344170 Chromosome and associated proteins [BR:ldo03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     LDBPK_344170 Cilium and associated proteins [BR:ldo03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    LDBPK_344170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ADIP IFT57 HMMR_C Lebercilin DUF3450 PDC10_C Golgin_A5 Occludin_ELL CCDC28 CorA COG6_N BRE1 SKA2 FliD_N CLZ Mis12 Motif Other DBs NCBI-GeneID:  13387455 NCBI-ProteinID:  XP_003864577 UniProt:  A0A3S7X8K8 LinkDB All DBs Position 34:1677717..1678043 Genome browser AA seq 108 aa AA seqDB search MAALGSDVQATSVELVSVIEKMKERKTLLEEQIAAEEAEYEGVLAEVRAMQERLSALKDS LAKKQAVRADLERTISETYSAFKSILDASKKLLSTAKEESSVLKAQIE NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctgctctcgggtcggatgtgcaggccaccagtgtcgagctcgtctctgtgattgag aaaatgaaggagcgcaagacgttacttgaagagcaaatcgctgccgaggaggctgagtac gagggtgtgcttgccgaagtgcgcgctatgcaggagagactctccgccctgaaagacagt ctcgcgaagaagcaggcggtgcgagcggacttggagcggaccatatcggagacgtactcg gcgttcaagagcatcctagacgcttccaagaagctgctctccaccgccaaggaagagtca tcggtgctcaaggcgcagatagaatga

DBGET integrated database retrieval system