Leclercia sp. J807: GNG26_08340 Help Entry GNG26_08340       CDS       T06440                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lea  Leclercia sp. J807 Pathway lea01100   Metabolic pathways lea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GNG26_08340 (acpP)    00074 Mycolic acid biosynthesis     GNG26_08340 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GNG26_08340 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  QGU10358 LinkDB All DBs Position 1783184..1783420 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagtgaccaacaatgcttctttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system