Lentzea guizhouensis: BBK82_26265 Help Entry BBK82_26265       CDS       T04448                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism led  Lentzea guizhouensis Pathway led01100   Metabolic pathways led01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:led00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBK82_26265    00074 Mycolic acid biosynthesis     BBK82_26265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBK82_26265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANZ43034 UniProt:  A0A1B2HZ98 LinkDB All DBs Position 5318553..5318813 Genome browser AA seq 86 aa AA seqDB search MRAAEIGYVVKKLVIRESRLALDPSELADDEPLNGSLLRINSLGFLGMLVKLEDELDVTL PDDLFAGRKFTTVADIVDVVTTAVDS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atcagggcggctgagatcgggtacgtcgtgaagaagctggtcatccgcgagtcgcggctg gcgctcgacccctccgagctggccgacgacgagccgttgaacgggtcgttgctgcggatc aactcgctggggttcctcgggatgctggtgaagctggaggacgagctggacgtgacgctg ccggacgacctgttcgccggccgcaagttcacgaccgtcgcggacatcgtggacgtggtc acgacggcggtggactcgtga

DBGET integrated database retrieval system