Leclercia sp. W17: DVA44_00480
Help
Entry
DVA44_00480 CDS
T05987
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
lee
Leclercia sp. W17
Pathway
lee00770
Pantothenate and CoA biosynthesis
lee01100
Metabolic pathways
lee01240
Biosynthesis of cofactors
Module
lee_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
lee00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
DVA44_00480
Enzymes [BR:
lee01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
DVA44_00480
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
DUF3388
Motif
Other DBs
NCBI-ProteinID:
AXF62730
LinkDB
All DBs
Position
complement(93826..94305)
Genome browser
AA seq
159 aa
AA seq
DB search
MSTKAIYPGTFDPVTNGHIDIVTRAASMFDTVILAIAASPSKKPLFDLDERVALAKAATA
HLPNVDVVGFSDLMANFARAQQANILIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMP
SKEWSFISSTLVKEVARHAGDVTHFLPASVHQALMDKLK
NT seq
480 nt
NT seq
+upstream
nt +downstream
nt
atgagcacaaaagcgatttatccgggtacctttgatcctgtcaccaacggccatatcgat
atcgtcacgcgtgccgcaagcatgtttgacacggtgattttggcgattgccgccagcccc
agcaaaaagcccctgttcgatcttgatgagcgggttgcgctggcgaaagccgcaacggcg
catctgcccaatgttgacgtggtgggctttagcgatctgatggcgaattttgcccgcgct
cagcaggccaatatcttaattcgtgggctgcgcgcggtggccgattttgaatatgagatg
cagctggcgcacatgaaccgccatctgatgcccgagctggagagcgtctttctgatgcca
tccaaagagtggtcgtttatctcttctactctggtgaaagaggtggcgcgccatgcaggt
gacgtcacccatttcttacccgccagcgtgcatcaggcgctgatggacaagctgaaataa
DBGET
integrated database retrieval system