KEGG   Leclercia sp. W17: DVA44_09785
Entry
DVA44_09785       CDS       T05987                                 
Name
(GenBank) C4-dicarboxylic acid transporter DauA
  KO
K03321  sulfate permease, SulP family
Organism
lee  Leclercia sp. W17
Brite
KEGG Orthology (KO) [BR:lee00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lee02000]
    DVA44_09785
Transporters [BR:lee02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   DVA44_09785
SSDB
Motif
Pfam: Sulfate_transp STAS STAS_2
Other DBs
NCBI-ProteinID: AXF66979
LinkDB
Position
complement(1990961..1992640)
AA seq 559 aa
MVKNASSHVLPFRALIDACWKEKYTLSRFTRDLIAGITVGIIAIPLAMALAIGSGVAPQY
GLYTAAVAGIVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLGGLLVATLMSGVFLILFG
LARFGRLIEYIPLSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALAMALPT
TNLGDAAIGVVTLGTLILWPRLGIRLPGHLPALLLGCAVMGIVNLLGGHVATIGSQFHYV
LADGSQGNGIPQLLPQLVLPWDLPGSSFTLSWDSLRALLPAAFSMAMLGAIESLLCAVVL
DGMTGTKHKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPVSAVVHSVLV
ILALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVINLLRRAPKDDIIVMLICMSLTVL
FDMVIAISVGIVLASLLFMRRIARMTRLASVNVSTPEDVLVLRVIGPLFFAAAEGLFSEL
ESRIVGKRVVVLKWDAVPVLDAGGLDAFQRFVQRLPEGCELRVTNLEFQPLRTMARAGVQ
PISGRLAFYPDREAALADL
NT seq 1680 nt   +upstreamnt  +downstreamnt
attgtgaaaaacgcttcctctcatgttcttcccttccgcgccctcatcgacgcctgctgg
aaagagaaatataccctgtcacgcttcactcgtgacctgatcgccgggatcaccgtcggt
atcattgccattccgctggcgatggcgctggccattggcagcggcgtagcgccgcagtat
ggcctctacactgccgccgtcgccgggattgtgattgccctgaccggtgggtcgcgcttc
agcgtctccgggccgaccgcggcctttgtggtgatcctctatccggtttctcagcagttt
ggtctgggcggattgctggtggcgaccctgatgtccggggtatttttgattttgttcggt
ctggcgcgctttggcaggctgattgagtacattccactttccgtgaccctgggctttacc
tccgggatcggcatcaccatcggcaccatgcagattaaggatttccttggcttacagatg
gcccacgtgccggagcattacctgcaaaaagtgggggcgctggcgatggcgctgccgacg
acaaacctgggcgatgcggcgattggcgtggtgaccctgggcacgctgatcctctggcca
cggctgggcatccgcctgccaggacacctgcccgccctgctgctgggctgcgcggtgatg
gggatagtcaatctgctgggcggccacgtcgccactatcggctcgcagttccactatgtg
ttggcggatggctcccagggtaacggtattccgcagcttctgccccagctggtgctgccg
tgggatctgcccggctccagctttaccttaagctgggactccctgcgcgccctgctgcca
gccgcattttcgatggcgatgttgggggcgattgagtcgctgctctgcgccgtggtgctg
gacggcatgaccggcaccaaacataaagccaacagcgagctggtcggccagggactgggg
aatattatcgccccgttcttcggcggcattaccgccacagcggccatcgcccgttccgcg
gccaacgtgcgcgcgggcgccacgtccccggtctcggcggtggtccattcggtgctggtg
atcctcgccctgctggtgctggcgcccttgctctcctggctgccgctctcggccatggcc
gccctgctgctgatggtggcatggaacatgagcgaggcacataaagtcatcaacctgctg
cgccgcgcccccaaagacgacatcatcgtaatgctgatctgcatgtcgctgacggtgctg
tttgacatggtcattgcgataagcgtcgggattgtgctggcatcattactgtttatgcgt
cgcattgcccgtatgacccgcctggccagcgtcaatgtctccacgccggaagacgtgctg
gtgctgcgagtcatcggcccgctgttttttgccgccgcggaaggattgttcagcgaactg
gagtcgcgcattgtcgggaaacgtgtcgtggtgctgaaatgggatgcggtcccggtgctg
gatgccggcgggctggacgccttccagcgttttgtacaacgtctgccggaaggctgtgaa
ctgcgggtgaccaatctcgaattccagcccctgcgcacgatggcgcgcgcaggggttcag
cccatttcgggccgtctggcgttctatcctgaccgtgaggcggcgttagcggatctgtga

DBGET integrated database retrieval system