Leclercia sp. W17: DVA44_14990 Help Entry DVA44_14990       CDS       T05987                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lee  Leclercia sp. W17 Pathway lee01100   Metabolic pathways lee01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lee00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DVA44_14990    00074 Mycolic acid biosynthesis     DVA44_14990   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DVA44_14990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AXF65315 LinkDB All DBs Position complement(3017867..3018103) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagtgaccaacaatgcttctttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system