Leclercia sp. W17: DVA44_15170 Help Entry DVA44_15170       CDS       T05987                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism lee  Leclercia sp. W17 Brite KEGG Orthology (KO) [BR:lee00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:lee03400]     DVA44_15170 DNA repair and recombination proteins [BR:lee03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     DVA44_15170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  AXF65348 LinkDB All DBs Position 3049588..3049833 Genome browser AA seq 81 aa AA seqDB search MRIEVTIARTTPLPAGALDALAGELSRRINNSFPEREGAVTVRYAGSNNLSVIGGAKDDK ERISEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaagtgaccattgccagaacaacgcctttgcctgctggtgcgctggatgca ctggcgggtgaattatcccgccgtataaacaactcctttcccgaacgcgaaggtgccgtc accgtgcgttatgcggggtcaaacaatctctcggtcatcggtggcgcaaaagatgataaa gagcgcatcagcgaaattttacaggaaacctgggagagcgctgacgactggtttattacc gattaa

DBGET integrated database retrieval system