Lelliottia jeotgali: LJPFL01_0404 Help Entry LJPFL01_0404      CDS       T05035                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism lef  Lelliottia jeotgali Pathway lef02024   Quorum sensing lef03018   RNA degradation Brite KEGG Orthology (KO) [BR:lef00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     LJPFL01_0404  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     LJPFL01_0404  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lef03019]     LJPFL01_0404    03036 Chromosome and associated proteins [BR:lef03036]     LJPFL01_0404 Messenger RNA biogenesis [BR:lef03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      LJPFL01_0404 Chromosome and associated proteins [BR:lef03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     LJPFL01_0404 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ASV53767 LinkDB All DBs Position 430584..430895 Genome browser AA seq 103 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGTGSNFHHGSNAQGSSAPAQDSEETE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcttgaacgcattgcgtcgtgaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaaggccagattgagtctttcgat cagttcgtgattctgttgaaaaacacggtcagccagatggtgtataagcacgctatttct actgttgttccgtcccgtccagtatctcatcacagcaacaacgctggcggtggcaccggt agtaatttccatcatggcagcaacgcacagggctcttctgcacctgcgcaggacagcgaa gaaaccgagtaa

DBGET integrated database retrieval system