Leptospirillum sp. Group II: ABH19_11500 Help Entry ABH19_11500       CDS       T04007                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism leg  Leptospirillum sp. Group II Pathway leg01100   Metabolic pathways leg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:leg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABH19_11500    00074 Mycolic acid biosynthesis     ABH19_11500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABH19_11500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DnaT_2 HLH Motif Other DBs NCBI-ProteinID:  AKS24235 LinkDB All DBs Position complement(2280145..2280375) Genome browser AA seq 76 aa AA seqDB search MAIEERVKKIIAEQLGVEDEEVNPESRFVEDLGADSLDTVELVMALEEEFGIEIPDEDAE KIATVQNAIDYISERV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctattgaagagcgcgtcaaaaaaattattgctgaacagttgggtgttgaggatgag gaagtcaatccggagtcccgcttcgtggaagatctgggagccgattccctcgacacagtc gaactggtcatggcgctggaagaagagttcgggatcgagattccggatgaagatgccgaa aaaattgccaccgttcagaacgccatcgactatatcagcgagcgtgtttga

DBGET integrated database retrieval system