Leclercia sp. LSNIH3: C3F35_02905 Help Entry C3F35_02905       CDS       T05316                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism leh  Leclercia sp. LSNIH3 Brite KEGG Orthology (KO) [BR:leh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:leh03400]     C3F35_02905 DNA repair and recombination proteins [BR:leh03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     C3F35_02905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  AUY37802 LinkDB All DBs Position 586028..586273 Genome browser AA seq 81 aa AA seqDB search MRIEVTIARTTALPAGALDALAGEFSRRINDSFPEREGAVTVRYAGSNNLSVIGGAKEDK ERISEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtatcgaagtcaccattgccagaacaactgctttgcctgctggtgcgctggacgcg ctggcgggtgaattttcccgccgtataaatgactcctttcccgaacgcgaaggtgctgtc accgtgcgttatgccgggtctaacaatctttcggttatcggtggtgccaaagaagataaa gaacgcatcagcgaaattttacaggaaacctgggaaagcgctgacgactggtttattacc gattaa

DBGET integrated database retrieval system