KEGG   Leclercia sp. LSNIH3: C3F35_06900
Entry
C3F35_06900       CDS       T05316                                 
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
leh  Leclercia sp. LSNIH3
Pathway
leh00430  Taurine and hypotaurine metabolism
leh00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:leh00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    C3F35_06900
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    C3F35_06900
Enzymes [BR:leh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     C3F35_06900
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AUY38530
LinkDB
Position
complement(1419981..1420832)
AA seq 283 aa
MSERLTITPLGPYIGAQISGLDVTRPLSDNQFEQLYHAVLRHQVVFLREQAITPQQQRAL
ALRFGDLHIHPVYPHAEGVEEIIVLDTHNDNPPDNDNWHTDVTFIDTPPAGAILAAKQLP
DSGGDTLWASGIAAFEALSAPLRQLLSGLRAEHDFKKSFPEYKYRKTEEEHQRWREAVAK
HPPLLHPVVRTHPVSGKQALFVNEGFTTRIVDVSEKESEALLGFLFAHITKPEFQVRWRW
QENDLAIWDNRVTQHYANADYLPQRRIMQRATILGDKPFYRAP
NT seq 852 nt   +upstreamnt  +downstreamnt
atgagtgaacgtctgactattaccccgctggggccgtacattggtgcacagatttccggc
ctggatgtcacccgaccattaagtgataaccagtttgagcagctctatcacgcggtgcta
cgccatcaggtggtgttcctgcgggagcaggcgatcacgccccagcagcagcgcgccctg
gcgctccgttttggcgatctgcatatccatccggtctacccgcacgccgaaggggtggaa
gaaattatcgtgctggatacccacaatgataacccgccggacaacgataactggcacacc
gatgtcacctttattgacacgccgcctgccggggcgatcctcgcggccaaacagctgccg
gacagcggcggcgacaccctgtgggccagcgggatcgccgcatttgaggcgttatccgcg
ccgctccgccagctgctgagcggcctgcgggcggagcatgatttcaaaaaatccttcccg
gagtataagtaccgtaaaacggaagaggagcatcagcgctggcgggaggcggtggcaaaa
catcccccgctgctgcatccggttgtgcgcacccatccggtcagcggcaagcaggcgctg
ttcgttaacgaagggttcaccacgcggattgtggatgtgagtgagaaagagagcgaggcc
ctgctggggttcttgtttgcgcacatcaccaaaccggagtttcaggtgcgctggcgctgg
caggagaacgatctggcgatctgggataaccgggtgacgcagcattacgcgaatgcagat
tacctgccgcagcggcggattatgcagcgggcaacgattttaggggataagcctttttat
cgtgcgccctga

DBGET integrated database retrieval system