Leclercia sp. LSNIH1: C2U54_03890 Help Entry C2U54_03890       CDS       T05297                                  Name (GenBank) peptidylprolyl isomerase   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism lei  Leclercia sp. LSNIH1 Brite KEGG Orthology (KO) [BR:lei00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lei03110]     C2U54_03890 Enzymes [BR:lei01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      C2U54_03890 Chaperones and folding catalysts [BR:lei03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     C2U54_03890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase_3 Rotamase Rotamase_2 Motif Other DBs NCBI-ProteinID:  AUU83210 UniProt:  A0AAD0GE43 LinkDB All DBs Position 745798..746079 Genome browser AA seq 93 aa AA seqDB search MKKSAAALHILVKEEKLAQEILAKLERGISFDHLAKRYSKCPSGRNGGDLGEFKQGVMVG PFDEAVFSCPLLKPCGPVKTKYGYHIIKVLYRR NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagagcgcagcggccctgcacattctggtaaaagaagagaagctggcgcaggag atccttgccaaactggaacgcggcatcagcttcgatcatctggcgaagcgctactctaaa tgtccctccgggcgcaacggcggcgatttaggggaatttaagcagggtgtgatggtgggc cctttcgatgaggcggtttttagctgcccgctgctaaaaccctgcggcccggtcaaaacg aagtatggctaccatatcattaaggtgctgtatcgccgctaa

DBGET integrated database retrieval system