Leclercia sp. LSNIH1: C2U54_06860 Help Entry C2U54_06860       CDS       T05297                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism lei  Leclercia sp. LSNIH1 Pathway lei02024   Quorum sensing lei03018   RNA degradation Brite KEGG Orthology (KO) [BR:lei00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     C2U54_06860  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     C2U54_06860  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lei03019]     C2U54_06860    03036 Chromosome and associated proteins [BR:lei03036]     C2U54_06860 Messenger RNA biogenesis [BR:lei03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      C2U54_06860 Chromosome and associated proteins [BR:lei03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     C2U54_06860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Herpes_capsid Hfq_1 Motif Other DBs NCBI-ProteinID:  AUU83750 LinkDB All DBs Position 1362023..1362331 Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGSSNYHHGSNAQGSSAPAQDSEETE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcttgaacgcactgcgtcgggaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaaggtcagattgaatctttcgat cagttcgtgatcctgttgaaaaacacggtcagccagatggtttataagcacgcgatttct actgttgttccgtctcgcccggtatctcatcacagcaataacgctggcggcggttccagt aactaccatcatggcagcaacgcgcagggttcttctgcgcctgcgcaggacagcgaagag accgaataa

DBGET integrated database retrieval system