Leclercia sp. LSNIH1: C2U54_13455 Help Entry C2U54_13455       CDS       T05297                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism lei  Leclercia sp. LSNIH1 Pathway lei02020   Two-component system lei02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:lei00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     C2U54_13455  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     C2U54_13455  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:lei02035]     C2U54_13455 Bacterial motility proteins [BR:lei02035]  Flagellar system   Flagellar assembly proteins    Others     C2U54_13455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AUU84944 UniProt:  A0AAD0DE76 LinkDB All DBs Position complement(2727408..2727695) Genome browser AA seq 95 aa AA seqDB search MSIDRTSPLKPVSPVQPREMNDTATAKTRPQKSATANSTSVTLSDAQAKLMQPGSNDINM ERVEALKTAIRNGELKMDTSKIADALIQDAQSFLE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagcattgatcgtacatcgcccctgaagccggttagcccagttcaaccgcgcgaaatg aatgacactgccactgcaaagactcgcccgcaaaaatcggcgaccgccaacagcaccagc gtcacgctgagcgatgcccaggcgaaactgatgcagcctggtagcaacgatatcaacatg gagcgtgttgaagcgctgaaaaccgccatccgcaatggcgagctgaaaatggataccagt aaaatcgctgatgcgctgatccaggatgcgcaaagtttcttagagtaa

DBGET integrated database retrieval system