Leclercia sp. LSNIH1: C2U54_21170 Help Entry C2U54_21170       CDS       T05297                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism lei  Leclercia sp. LSNIH1 Brite KEGG Orthology (KO) [BR:lei00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lei03036]     C2U54_21170    03400 DNA repair and recombination proteins [BR:lei03400]     C2U54_21170 Chromosome and associated proteins [BR:lei03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     C2U54_21170 DNA repair and recombination proteins [BR:lei03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       C2U54_21170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS_N OmdA LPD5 NleF_casp_inhib Cgr1 DUF6563 PDEase_I Motif Other DBs NCBI-ProteinID:  AUU86370 UniProt:  A0AAD0DH99 LinkDB All DBs Position complement(4294831..4295067) Genome browser AA seq 78 aa AA seqDB search MIDEFHVMYMYKKIQAEAATTDMKTLEQLLKKFRQVVAERREEYYQEIGEKKAQKLRAKR LQQLLEKMGRDRISPDEL NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgattgatgaatttcatgttatgtatatgtataaaaaaatacaagctgaagctgcgaca acagatatgaaaacactggaacagcttttgaagaagttccgtcaagtcgttgcggaacgc cgggaagaatactatcaggagattggtgagaaaaaggctcagaaattgagagccaagaga ttacaacagttgcttgagaaaatggggcgtgatcgtatatcaccagatgaattataa

DBGET integrated database retrieval system