Leifsonia sp. PS1209: HF024_08860 Help Entry HF024_08860       CDS       T06547                                  Name (GenBank) thioredoxin   KO K00384   thioredoxin reductase (NADPH) [EC:1.8.1.9] Organism leif  Leifsonia sp. PS1209 Pathway leif00450   Selenocompound metabolism Brite KEGG Orthology (KO) [BR:leif00001]  09100 Metabolism   09106 Metabolism of other amino acids    00450 Selenocompound metabolism     HF024_08860 Enzymes [BR:leif01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.1  With NAD+ or NADP+ as acceptor     1.8.1.9  thioredoxin-disulfide reductase (NADPH)      HF024_08860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_9 Thioredoxin_3 Glutaredoxin Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  QIZ98604 LinkDB All DBs Position 1875036..1875344 Genome browser AA seq 102 aa AA seqDB search MDSTSAVGRPVTDGDAVRLTLYTSAFCEPCMQTRAVLAEAARLVPLVTVTELDVARNLQS AEADRIRVTPTVIVATAAGDEVFRAEGVPTLQQVLVAAAKAV NT seq 309 nt NT seq  +upstreamnt  +downstreamnt gtggattcgacatcggccgttggccgtcccgtcaccgacggagacgctgtccggctcacc ctgtacacgtcggcgttctgcgaaccgtgcatgcagacgcgcgccgtgctggccgaggcg gcgcggctcgtgccgctggtgaccgtgaccgagctggacgtcgcccgcaacctgcagagc gcggaggccgaccgcatccgggtcacccccacggtgatcgtggcgacggctgccggcgac gaggtgttccgcgcggagggcgttccgacgctgcagcaggtgctggtcgccgcggcgaaa gcggtctga

DBGET integrated database retrieval system