Leisingera sp. M523: K3557_18470 Help Entry K3557_18470       CDS       T10661                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism leim  Leisingera sp. M523 Brite KEGG Orthology (KO) [BR:leim00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:leim03032]     K3557_18470    03036 Chromosome and associated proteins [BR:leim03036]     K3557_18470    03400 DNA repair and recombination proteins [BR:leim03400]     K3557_18470 DNA replication proteins [BR:leim03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     K3557_18470 Chromosome and associated proteins [BR:leim03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     K3557_18470 DNA repair and recombination proteins [BR:leim03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       K3557_18470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 DUF2267 Motif Other DBs NCBI-ProteinID:  UWQ28698 LinkDB All DBs Position 3740947..3741234 Genome browser AA seq 95 aa AA seqDB search MSKPMTKTQLVAALADEMGSDKKVAGSALEAVCSLITREVSGGGAVTLPGVGKIYCRERP EREVRNPATGEKFTKEADKVVKMTIAKALKDSVNG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtccaaaccgatgaccaaaacccagcttgttgccgctctggctgacgaaatgggcagc gacaaaaaagtcgcaggttccgctctggaagcggtctgctcgctgatcacccgcgaagtg tcgggcggcggtgccgtgaccctgccgggcgtcggcaagatctattgccgcgagcgcccc gagcgcgaagtgcgcaacccggccaccggcgagaagttcacaaaagaagctgacaaggtt gtgaaaatgaccatcgcaaaggcgttgaaagacagcgtgaacggctga

DBGET integrated database retrieval system