Leishmania sp. Namibia: 94185178 Help Entry 94185178          CDS       T10410                                  Symbol JIQ42_01436 Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism lein  Leishmania sp. Namibia Pathway lein03020   RNA polymerase lein03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:lein00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     94185178 (JIQ42_01436)   09124 Replication and repair    03420 Nucleotide excision repair     94185178 (JIQ42_01436)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:lein03021]     94185178 (JIQ42_01436)    03400 DNA repair and recombination proteins [BR:lein03400]     94185178 (JIQ42_01436) Transcription machinery [BR:lein03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      94185178 (JIQ42_01436)   RNA polymerase III system    RNA polymerase III      94185178 (JIQ42_01436)   RNA polymerase I system    RNA polymerase I      94185178 (JIQ42_01436) DNA repair and recombination proteins [BR:lein03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       94185178 (JIQ42_01436) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 DUF2169 Motif Other DBs NCBI-GeneID:  94185178 NCBI-ProteinID:  XP_067705772 LinkDB All DBs Position 34:429831..430310 Genome browser AA seq 159 aa AA seqDB search MSDRDDEDDLLSLNLGDDREDGDSGSDIQRSGADEEDEDGGEQLPEDVAANVILSGNAQA AKGARARGITERVTTAVMTKYERARVLGTRALQISMNAPVAVALEGETDPLTIAVKELRE RRTPLIIRRILPDNTYEDWSVSELLVDFDRPADERYTNI NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgtcggaccgcgacgacgaagacgacctcctcagcctcaatctgggcgatgaccgtgaa gacggcgatagcggcagcgatatccagcgcagcggcgcggacgaggaggacgaagatgga ggcgagcagctacctgaagacgttgcggccaatgtcatcctgtcgggcaacgcgcaagct gcaaagggtgcgcgggcccgcggcatcaccgagcgcgtgacgactgccgttatgaccaag tatgagcgagcacgtgtgctgggtacgcgcgcgctgcaaattagcatgaacgccccggta gctgtggcactcgagggtgaaacagatccgctgacgattgccgtgaaagaactgcgagag cgccgcacgccgctgattattcgtcgcatcctgccggacaacacgtacgaggattggagc gtgagcgagctactcgtggactttgatcgtccggcggacgagcgctacactaacatctaa

DBGET integrated database retrieval system