Leishmania sp. Namibia: 94185898 Help Entry 94185898          CDS       T10410                                  Symbol JIQ42_02173 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism lein  Leishmania sp. Namibia Pathway lein04145   Phagocytosis lein04517   IgSF CAM signaling lein04814   Motor proteins Brite KEGG Orthology (KO) [BR:lein00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     94185898 (JIQ42_02173)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     94185898 (JIQ42_02173)   09142 Cell motility    04814 Motor proteins     94185898 (JIQ42_02173)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lein03037]     94185898 (JIQ42_02173)    04812 Cytoskeleton proteins [BR:lein04812]     94185898 (JIQ42_02173) Cilium and associated proteins [BR:lein03037]  Motile cilia and associated proteins   Dynein arm    94185898 (JIQ42_02173) Cytoskeleton proteins [BR:lein04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      94185898 (JIQ42_02173) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ectatomin Ig_TRS130_1st NtdA_N Peptidase_C3 Motif Other DBs NCBI-GeneID:  94185898 NCBI-ProteinID:  XP_067706492 LinkDB All DBs Position 32:complement(<112204..>112479) Genome browser AA seq 91 aa AA seqDB search MYNNDHKATVKNADMPEDMQADAIEVTLQAMEKFNIEKDIAAYIKKEFDKKYQPTWHCIV GRNFGSFVTHDTHCFLYFYLGQVAVLLFKCG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtacaacaacgaccacaaggccacggtgaagaacgccgacatgccggaggacatgcag gcggatgcgatagaggtgacgctgcaggcgatggagaagttcaacattgagaaggatatt gcggcctacatcaagaaggagttcgacaagaagtaccaaccgacatggcattgcattgtg ggtcgcaacttcggcagcttcgtgacgcacgacacccattgcttcctgtatttctacctc ggccaggttgcggtgctgctgttcaagtgcgggtaa

DBGET integrated database retrieval system