Leishmania sp. Namibia: 94186878 Help Entry 94186878          CDS       T10410                                  Symbol JIQ42_03191 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism lein  Leishmania sp. Namibia Pathway lein04145   Phagocytosis lein04517   IgSF CAM signaling lein04814   Motor proteins Brite KEGG Orthology (KO) [BR:lein00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     94186878 (JIQ42_03191)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     94186878 (JIQ42_03191)   09142 Cell motility    04814 Motor proteins     94186878 (JIQ42_03191)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lein03037]     94186878 (JIQ42_03191)    04812 Cytoskeleton proteins [BR:lein04812]     94186878 (JIQ42_03191) Cilium and associated proteins [BR:lein03037]  Motile cilia and associated proteins   Dynein arm    94186878 (JIQ42_03191) Cytoskeleton proteins [BR:lein04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      94186878 (JIQ42_03191) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light PapC_C Motif Other DBs NCBI-GeneID:  94186878 NCBI-ProteinID:  XP_067708133 LinkDB All DBs Position 28:<869695..>869967 Genome browser AA seq 90 aa AA seqDB search MTQVPNATVKLSEMPKEMENFAIFCAQEGLAKLQTAQELASFVRKEFESKYGPTWNCFVG RNFGSFVTHEEGNYVYFYVGQTGVLLFKSS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagtacctaacgcgacggtgaagctctccgagatgccgaaggagatggagaac tttgccattttttgtgcgcaggaggggctcgcgaaactacaaactgcgcaggagctagcc agttttgttcgaaaggagtttgaaagcaagtatggaccgacgtggaactgctttgtcggg cgaaacttcggcagctttgttacacatgaagagggtaactatgtgtacttctacgttggt cagaccggcgttctgcttttcaagtcttcctag

DBGET integrated database retrieval system