Leishmania sp. Namibia: 94188561 Help Entry 94188561          CDS       T10410                                  Symbol JIQ42_04913 Name (RefSeq) hypothetical protein   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism lein  Leishmania sp. Namibia Pathway lein03018   RNA degradation lein03040   Spliceosome Brite KEGG Orthology (KO) [BR:lein00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     94188561 (JIQ42_04913)   09123 Folding, sorting and degradation    03018 RNA degradation     94188561 (JIQ42_04913)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lein03019]     94188561 (JIQ42_04913)    03041 Spliceosome [BR:lein03041]     94188561 (JIQ42_04913) Messenger RNA biogenesis [BR:lein03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      94188561 (JIQ42_04913)   mRNA degradation factors    5'-3' decay     Lsm complex      94188561 (JIQ42_04913) Spliceosome [BR:lein03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     94188561 (JIQ42_04913) SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF6800 Cadherin_2 Motif Other DBs NCBI-GeneID:  94188561 NCBI-ProteinID:  XP_067708488 LinkDB All DBs Position 26:complement(<43218..>43562) Genome browser AA seq 114 aa AA seqDB search MPPSAVTERQLELRRLNHRVAKIMSAEAAHILKKKEGILSLEKYLDRKVVVSQKGHEVHG VLKGFDNNVNLVLADAELWHRNTRIRTIGACVVRGGPVNLVLSGDVAVIANPFS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgcctccctccgcagtcacagagaggcagttggagctgagacgactgaaccatagagtc gcgaagataatgtctgcggaggcggcgcacattctcaagaagaaagagggtattttgtcc ttggagaagtacctcgatcgtaaagtcgtggtttcccagaaaggccacgaagtgcacggc gtattaaaagggtttgacaataatgtaaacttggttcttgccgacgcagagctttggcac cgcaacacgcgcatccgcaccatcggcgcttgcgttgtgcgcggtggtcctgtcaatctc gtcctctccggtgacgttgctgtgattgcaaaccccttctcttag

DBGET integrated database retrieval system