Leishmania sp. Ghana 2012 LV757: 94178468 Help Entry 94178468          CDS       T10390                                  Symbol GH5_02970 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism leis  Leishmania sp. Ghana 2012 LV757 Pathway leis04145   Phagocytosis leis04517   IgSF CAM signaling leis04814   Motor proteins Brite KEGG Orthology (KO) [BR:leis00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     94178468 (GH5_02970)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     94178468 (GH5_02970)   09142 Cell motility    04814 Motor proteins     94178468 (GH5_02970)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:leis03037]     94178468 (GH5_02970)    04812 Cytoskeleton proteins [BR:leis04812]     94178468 (GH5_02970) Cilium and associated proteins [BR:leis03037]  Motile cilia and associated proteins   Dynein arm    94178468 (GH5_02970) Cytoskeleton proteins [BR:leis04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      94178468 (GH5_02970) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ectatomin Ig_TRS130_1st NtdA_N Peptidase_C3 Motif Other DBs NCBI-GeneID:  94178468 NCBI-ProteinID:  XP_067698356 LinkDB All DBs Position 32:complement(<81789..>82064) Genome browser AA seq 91 aa AA seqDB search MYNNDHKATVKNADMPEDMQADAIEVTLQAMEKFNIEKDIAAYIKKEFDKKYQPTWHCIV GRNFGSFVTHDTHCFLYFYLGQVAVLLFKCG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtacaacaacgaccacaaggccacggtgaagaacgccgacatgccggaggacatgcag gcggatgcgatagaggtgacgctgcaggcgatggagaagttcaacattgagaaggatatt gcggcctacatcaagaaggagttcgacaagaagtaccaaccaacatggcattgcattgtg ggtcgcaacttcggcagcttcgtgacgcatgacacccattgcttcctgtatttctacctc ggccaggtcgcggtgctgctcttcaagtgcgggtaa

DBGET integrated database retrieval system