Leishmania sp. Ghana 2012 LV757: 94179401 Help Entry 94179401          CDS       T10390                                  Symbol GH5_03945 Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism leis  Leishmania sp. Ghana 2012 LV757 Pathway leis03020   RNA polymerase leis03420   Nucleotide excision repair Brite Transcription machinery [BR:leis03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      94179401 (GH5_03945)   RNA polymerase III system    RNA polymerase III      94179401 (GH5_03945)   RNA polymerase I system    RNA polymerase I      94179401 (GH5_03945) DNA repair and recombination proteins [BR:leis03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       94179401 (GH5_03945) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  94179401 NCBI-ProteinID:  XP_067699855 UniProt:  A0A836IPB7 LinkDB All DBs Position 28:320335..320784 Genome browser AA seq 149 aa AA seqDB search MSANPVILEDTFTVNGVNTEGTVYLRVSRIRCVNQDGSLTITTDINSEEFPVSTNDRLTI VLANSLELGGKTGSKYYDHSVYHRETRLNDCDYAMHGRVYGHEVVENGLEVNVHISCGGL LVNIVGKPQGLRDVHYNSDVYILIKRVKN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgagtgccaaccccgtcattctcgaagacaccttcacggtgaatggtgtcaacaccgaa ggtacggtgtaccttcgagtctcgcgtattcgttgcgttaatcaagatggctcgctcacc attacgacagacatcaactcggaggagttccctgtttccacgaacgatcgtctgacgatc gtgctggccaactcgcttgagcttgggggcaagacggggagcaagtactacgaccacagt gtttaccaccgcgagacgcggttgaacgactgcgactacgccatgcacggtcgcgtctac ggacacgaggtagtcgagaacggcctagaggtgaatgtgcacattagctgtggtggtctg ctagtgaacattgttggtaagccacaggggctgcgagatgtgcactacaacagcgatgtg tacattctcatcaagcgtgtcaaaaattag

DBGET integrated database retrieval system