Leishmania sp. Ghana 2012 LV757: 94179551 Help Entry 94179551          CDS       T10390                                  Symbol GH5_04100 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism leis  Leishmania sp. Ghana 2012 LV757 Pathway leis04145   Phagocytosis leis04517   IgSF CAM signaling leis04814   Motor proteins Brite KEGG Orthology (KO) [BR:leis00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     94179551 (GH5_04100)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     94179551 (GH5_04100)   09142 Cell motility    04814 Motor proteins     94179551 (GH5_04100)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:leis03037]     94179551 (GH5_04100)    04812 Cytoskeleton proteins [BR:leis04812]     94179551 (GH5_04100) Cilium and associated proteins [BR:leis03037]  Motile cilia and associated proteins   Dynein arm    94179551 (GH5_04100) Cytoskeleton proteins [BR:leis04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      94179551 (GH5_04100) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light PapC_C Motif Other DBs NCBI-GeneID:  94179551 NCBI-ProteinID:  XP_067700005 LinkDB All DBs Position 28:<902560..>902832 Genome browser AA seq 90 aa AA seqDB search MTQVPNATVKLSEMPKEMENFAIFCAQEGLAKLQTAQELASFVRKEFESKYGPTWNCFVG RNFGSFVTHEEGNYVYFYVGQTGVLLFKSS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagtacctaacgcgacggtgaagctctccgagatgccgaaggagatggagaac tttgccattttttgtgcgcaggaggggctggcgaaactgcaaactgcgcaggagctagcc agttttgttcgaaaggagtttgaaagcaagtatggaccgacgtggaactgctttgtcggg cgaaacttcggcagctttgttacacatgaagaaggtaactatgtgtacttctacgttggt cagaccggcgttctgcttttcaagtcttcctag

DBGET integrated database retrieval system