Leishmania sp. Ghana 2012 LV757: 94180469 Help Entry 94180469          CDS       T10390                                  Symbol GH5_05060 Name (RefSeq) hypothetical protein   KO K04078   chaperonin GroES Organism leis  Leishmania sp. Ghana 2012 LV757 Brite KEGG Orthology (KO) [BR:leis00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:leis03110]     94180469 (GH5_05060)    03029 Mitochondrial biogenesis [BR:leis03029]     94180469 (GH5_05060) Chaperones and folding catalysts [BR:leis03110]  Heat shock proteins   HSP10    94180469 (GH5_05060) Mitochondrial biogenesis [BR:leis03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     94180469 (GH5_05060) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF8093 Motif Other DBs NCBI-GeneID:  94180469 NCBI-ProteinID:  XP_067700429 LinkDB All DBs Position 26:complement(<177079..>177381) Genome browser AA seq 100 aa AA seqDB search MFRFTAPALKKLQPLGQRVLVRRMQAAKQTKAGILIPEQVAGKVNEGTVVAVAAGSKDWT PTVKVNDTVLLPEYGGSAVKVDGEELYLYDESMLLGVLSS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgttccgtttcactgcccctgccctgaagaagctgcagccgctgggccagcgtgtgctg gtgaggcggatgcaggcggcgaagcagaccaaggccggcatcctgatccctgagcaggtg gccgggaaggtcaacgagggcaccgtcgtggctgtggcggcggggtcgaaggactggaca ccgacggtgaaggtgaacgacacggtgctgctgccggagtacggcggctctgctgtgaag gtggatggcgaggagctctacctttacgatgagagcatgctgcttggcgtgctgtccagc tga

DBGET integrated database retrieval system