Leishmania sp. Ghana 2012 LV757: 94183174 Help Entry 94183174          CDS       T10390                                  Symbol GH5_07954 Name (RefSeq) hypothetical protein   KO K10420   dynein light chain Tctex-type 1/3 Organism leis  Leishmania sp. Ghana 2012 LV757 Pathway leis04145   Phagocytosis leis04814   Motor proteins Brite KEGG Orthology (KO) [BR:leis00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     94183174 (GH5_07954)   09142 Cell motility    04814 Motor proteins     94183174 (GH5_07954)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:leis03037]     94183174 (GH5_07954)    04812 Cytoskeleton proteins [BR:leis04812]     94183174 (GH5_07954) Cilium and associated proteins [BR:leis03037]  Motile cilia and associated proteins   Dynein arm    94183174 (GH5_07954) Cytoskeleton proteins [BR:leis04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      94183174 (GH5_07954) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 NOMO_6th DUF5775 Motif Other DBs NCBI-GeneID:  94183174 NCBI-ProteinID:  XP_067703922 LinkDB All DBs Position 5:<184990..>185325 Genome browser AA seq 111 aa AA seqDB search MASADRITLVDDASVICEDVVNSLFNHETRYQHHKVAGLVSAISDQVVQRLTQEAKLPRK YVVLVTILQKNGAGVQMISSCSWNPTSDACYVYTAENKAMHCIITVYGVTV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcctccgccgatcgtatcacattggtcgacgacgcctccgttatctgcgaagacgtc gtcaactctctcttcaaccatgaaacgcgctaccagcatcacaaggtcgctggcctcgtc tccgccatctccgatcaggtggtgcagcggttgacacaggaggcgaagctgccgcgcaag tacgttgtcctcgtcaccatcctgcagaagaatggtgctggcgtgcagatgatctcgtcg tgctcctggaaccccacgagcgacgcgtgttacgtatacacagcggaaaataaagccatg cattgcatcatcacggtctacggcgtcactgtgtag

DBGET integrated database retrieval system