Leifsonia sp. ZF2019: IT072_10680 Help Entry IT072_10680       CDS       T10186                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism leiz  Leifsonia sp. ZF2019 Pathway leiz01100   Metabolic pathways leiz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:leiz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IT072_10680    00074 Mycolic acid biosynthesis     IT072_10680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IT072_10680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UAJ77778 UniProt:  A0A9E6X031 LinkDB All DBs Position complement(2188655..2188906) Genome browser AA seq 83 aa AA seqDB search MALSTEEVLAGLAELINDETGIATDTVELDKSFTDDLDIDSISMMTIVVNAEDKFDVKIP DEEVKNLKTVGDAVEFIVKAQDA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcattgtccaccgaagaagttctcgccggcctggccgagctcatcaacgacgagacc ggcatcgcgaccgacacggttgagctggacaagtcgttcaccgacgacctcgacatcgac tccatctcgatgatgaccatcgtggtcaacgccgaggacaagttcgacgtcaagatcccc gacgaggaggtcaagaacctcaagacggtcggcgacgcggtcgagttcatcgtcaaggcg caggacgcctag

DBGET integrated database retrieval system