Lodderomyces elongisporus: PVL30_004168 Help Entry PVL30_004168      CDS       T01116                                  Symbol HUB1 Name (RefSeq) ubiquitin-like modifier hub1   KO K13113   ubiquitin-like protein 5 Organism lel  Lodderomyces elongisporus Brite KEGG Orthology (KO) [BR:lel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:lel03041]     PVL30_004168 (HUB1)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lel04052]     PVL30_004168 (HUB1) Spliceosome [BR:lel03041]  Complex B   Other components    Complex B specific factors     PVL30_004168 (HUB1) Cytokines and neuropeptides [BR:lel04052]  Neuropeptides   Unclassified    PVL30_004168 (HUB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Motif Other DBs NCBI-GeneID:  5231536 NCBI-ProteinID:  XP_001524480 UniProt:  A5E4B3 LinkDB All DBs Position 5:complement(817553..817774) Genome browser AA seq 73 aa AA seqDB search MIEIQANDRLGKKIRVKCLPTDTIGELKKVLALQIGTPYEKLILRKGHQVYKDHITLDDY EVHDGFNFELYYS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgagatacaggcaaacgatagattggggaaaaagattagagtaaagtgtttaccc actgatacaattggcgagttaaagaaagttcttgctttgcagattggtactccatacgaa aaattaatcttgagaaaaggtcatcaggtttacaaagatcatatcacgttggatgactat gaagttcacgatggattcaatttcgagctctactattcataa

DBGET integrated database retrieval system