Lysobacter enzymogenes M497-1: LEN_1057 Help Entry LEN_1057          CDS       T04598                                  Name (GenBank) cell division protein   KO K03586   cell division protein FtsL Organism lem  Lysobacter enzymogenes M497-1 Brite KEGG Orthology (KO) [BR:lem00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lem03036]     LEN_1057 Chromosome and associated proteins [BR:lem03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LEN_1057 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FtsL DivIC DUF5713 FtsL_2 RA_3 Motif Other DBs NCBI-ProteinID:  BAV96544 UniProt:  A0AAU9AFZ0 LinkDB All DBs Position 1201015..1201278 Genome browser AA seq 87 aa AA seqDB search MMRLLLVLLIVANVVSALLVVFARHEHRQLFVQLNKLQRQRDELNIEFGRLQLEQATWAE SNRIDQVARERIGMKFPEGGETVVIRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgatgcgcctgctgctggtcctgctgatcgtggccaacgtcgtctcggcgctgctggtg gtgttcgcccgccacgagcaccgccagttgttcgtgcagctcaacaagctgcagcgccag cgcgacgagctcaacatcgaattcggccggttgcaactggagcaggcgacctgggcggag agcaaccgcatcgaccaggtggcgcgcgagcgcatcgggatgaagtttcccgagggcggc gaaaccgtggtgatccgtccatga

DBGET integrated database retrieval system