Leptolyngbya sp. NIES-3755: LEP3755_31900 Help Entry LEP3755_31900     CDS       T04199                                  Name (GenBank) DNA binding protein HU   KO K03530   DNA-binding protein HU-beta Organism len  Leptolyngbya sp. NIES-3755 Brite KEGG Orthology (KO) [BR:len00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:len03032]     LEP3755_31900    03036 Chromosome and associated proteins [BR:len03036]     LEP3755_31900    03400 DNA repair and recombination proteins [BR:len03400]     LEP3755_31900 DNA replication proteins [BR:len03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LEP3755_31900 Chromosome and associated proteins [BR:len03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LEP3755_31900 DNA repair and recombination proteins [BR:len03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LEP3755_31900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  BAU12659 UniProt:  A0A0S3U592 LinkDB All DBs Position 3280870..3281151 Genome browser AA seq 93 aa AA seqDB search MNKGELVDAVAEKASVTKKQADAVLSAAIETIVEAVSSGDKVTLVGFGSFESRERKAREG RNPKTGDKMEIPATRVPAFSAGKLFKEKVAPED NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaggtgaactcgttgatgcagtggcagaaaaggcaagtgtcacgaaaaaacaa gccgatgcagtcctgtccgccgcgatcgaaacgatcgtcgaagcggtttcctctggtgac aaagtgaccttggtaggtttcggatcgtttgaatcgcgtgaacgcaaagcgcgggaagga cgcaaccccaaaactggcgataaaatggaaattcctgcaactcgcgttcctgcattttcg gcaggaaaactcttcaaagagaaggttgcacccgaagattaa

DBGET integrated database retrieval system