Leptolyngbya sp. NIES-3755: LEP3755_41330 Help Entry LEP3755_41330     CDS       T04199                                  Name (GenBank) cytochrome b559 beta subunit   KO K02708   photosystem II cytochrome b559 subunit beta Organism len  Leptolyngbya sp. NIES-3755 Pathway len00195   Photosynthesis len01100   Metabolic pathways Module len_M00161   Photosystem II len_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:len00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     LEP3755_41330  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:len00194]     LEP3755_41330 Photosynthesis proteins [BR:len00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     LEP3755_41330 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  BAU13593 LinkDB All DBs Position complement(4180047..4180181) Genome browser AA seq 44 aa AA seqDB search MTSNTPNEPISYPIFTVRWLAVHTLAVPAIFFIGAIASMQFIQR NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgactagcaacactccgaacgaaccgatttcatatccgatttttactgtccgctggttg gctgtgcatactttggcggttccggcgatctttttcattggcgcgatcgcatcaatgcaa tttattcaacgatag

DBGET integrated database retrieval system