Leishmania enriettii: 94170984 Help Entry 94170984          CDS       T10389                                  Symbol CUR178_03745 Name (RefSeq) hypothetical protein   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism lenr  Leishmania enriettii Pathway lenr03018   RNA degradation lenr03040   Spliceosome Brite KEGG Orthology (KO) [BR:lenr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     94170984 (CUR178_03745)   09123 Folding, sorting and degradation    03018 RNA degradation     94170984 (CUR178_03745)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lenr03019]     94170984 (CUR178_03745)    03041 Spliceosome [BR:lenr03041]     94170984 (CUR178_03745) Messenger RNA biogenesis [BR:lenr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      94170984 (CUR178_03745)   mRNA degradation factors    5'-3' decay     Lsm complex      94170984 (CUR178_03745) Spliceosome [BR:lenr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     94170984 (CUR178_03745) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF6800 Motif Other DBs NCBI-GeneID:  94170984 NCBI-ProteinID:  XP_067692040 UniProt:  A0A836GPT7 LinkDB All DBs Position 26:complement(21739..22083) Genome browser AA seq 114 aa AA seqDB search MPPCAVTERQLELRRLNHRVAKIMSAAAAHILKKKEGILSLEKYLDRKVVVSQKGHEVHG VLKGFDNNVNLVLADAELWHRDTRIRTIGACVVRGGPVNLVLSGDVAVIANPFS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgcctccctgcgcagtcacggagaggcagttggagctgagacgattgaaccatagagtc gcgaagataatgtctgcggcggcggcgcacattctcaagaagaaggagggtattttgtcc ttggagaagtacctcgatcgtaaagtcgtggtttcccagaaaggccacgaagtgcacggc gtattgaaagggttcgacaataatgtaaacttggttcttgccgacgcagagctttggcac cgcgacacgcgcatccgcaccatcggcgcttgtgttgtgcgcggtggtcctgtaaatctc gtcctctccggtgatgttgctgtgattgcaaaccccttctcttag

DBGET integrated database retrieval system