Leishmania enriettii: 94171653 Help Entry 94171653          CDS       T10389                                  Symbol CUR178_04435 Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism lenr  Leishmania enriettii Pathway lenr03020   RNA polymerase lenr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:lenr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     94171653 (CUR178_04435)   09124 Replication and repair    03420 Nucleotide excision repair     94171653 (CUR178_04435)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:lenr03021]     94171653 (CUR178_04435)    03400 DNA repair and recombination proteins [BR:lenr03400]     94171653 (CUR178_04435) Transcription machinery [BR:lenr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      94171653 (CUR178_04435)   RNA polymerase III system    RNA polymerase III      94171653 (CUR178_04435)   RNA polymerase I system    RNA polymerase I      94171653 (CUR178_04435) DNA repair and recombination proteins [BR:lenr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       94171653 (CUR178_04435) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  94171653 NCBI-ProteinID:  XP_067691514 UniProt:  A0A836HDR6 LinkDB All DBs Position 28:296454..296903 Genome browser AA seq 149 aa AA seqDB search MSANPVILEDTFTVNGVNTEGTVYIRVSRIRCVNQDGSLTITADINSEEFPVSTNDRLTI VLANSLELGGKTGSKYYDHSVYHRETRLNDCDYAMHGRVYGHEVVENGLEVNVHISCGGL LVNIFGKPQGLRDVHYNSDVYILIKRVKN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgagtgccaaccccgtcattctcgaggacaccttcacggtgaatggtgtcaacaccgaa ggtacggtgtacattcgagtctcgcgtattcgttgcgtcaatcaagatggctccctcacc attacagccgacatcaactcggaggagttccctgtttccacgaacgatcgtctgacgatc gtgctggccaactcccttgagcttgggggaaagacgggtagcaagtactacgaccacagt gtttaccaccgcgagacgcggttgaacgactgcgactacgccatgcacggtcgcgtctac ggacacgaggtagtcgagaacggcctagaggtgaatgtgcacattagctgtggtggtctg ctagtgaacattttcggtaagccacaggggcttcgagatgtgcactacaacagcgatgtg tacattctcatcaagcgtgtcaaaaattag

DBGET integrated database retrieval system