Leishmania enriettii: 94171806 Help Entry 94171806          CDS       T10389                                  Symbol CUR178_04589 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism lenr  Leishmania enriettii Pathway lenr04145   Phagocytosis lenr04517   IgSF CAM signaling lenr04814   Motor proteins Brite KEGG Orthology (KO) [BR:lenr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     94171806 (CUR178_04589)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     94171806 (CUR178_04589)   09142 Cell motility    04814 Motor proteins     94171806 (CUR178_04589)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lenr03037]     94171806 (CUR178_04589)    04812 Cytoskeleton proteins [BR:lenr04812]     94171806 (CUR178_04589) Cilium and associated proteins [BR:lenr03037]  Motile cilia and associated proteins   Dynein arm    94171806 (CUR178_04589) Cytoskeleton proteins [BR:lenr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      94171806 (CUR178_04589) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light YomF_N PapC_C Motif Other DBs NCBI-GeneID:  94171806 NCBI-ProteinID:  XP_067691667 UniProt:  A0A836HE88 LinkDB All DBs Position 28:<859024..>859296 Genome browser AA seq 90 aa AA seqDB search MTQVPNATVKLSEMPKEMENFAIFCAQEGLTKLQTAQELASFVRKEFESKYGPTWNCFVG RNFGSFVTHEEGNYVYFYVGQTGVLLFKSS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagtacctaatgcgacggtgaagctctccgagatgccgaaggagatggagaac tttgccatattttgtgcgcaggaggggctgacgaaactacaaactgcgcaggagctagcc agttttgttcgaaaggagtttgaaagcaagtatggaccgacgtggaactgctttgtcggg cgaaacttcggcagctttgttacacatgaagagggtaactatgtgtacttctacgttggt cagaccggggttctgcttttcaagtcttcctag

DBGET integrated database retrieval system