Leishmania enriettii: 94172324 Help Entry 94172324          CDS       T10389                                  Symbol CUR178_05119 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism lenr  Leishmania enriettii Pathway lenr04814   Motor proteins Brite KEGG Orthology (KO) [BR:lenr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     94172324 (CUR178_05119)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:lenr03037]     94172324 (CUR178_05119)    04812 Cytoskeleton proteins [BR:lenr04812]     94172324 (CUR178_05119) Cilium and associated proteins [BR:lenr03037]  Motile cilia and associated proteins   Dynein arm    94172324 (CUR178_05119) Cytoskeleton proteins [BR:lenr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      94172324 (CUR178_05119) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light N_NLPC_P60 Motif Other DBs NCBI-GeneID:  94172324 NCBI-ProteinID:  XP_067692356 UniProt:  A0A836HGH3 LinkDB All DBs Position 25:complement(111093..111362) Genome browser AA seq 89 aa AA seqDB search MSERKPDIKVADISPEMQADALDIASKAIKGHQLEKDMAAHIKREFDKRHFPTWHCIVGR NFGADVEHESKNFIYLYVGQMSVLLWKTA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgagcggaagccggacatcaaggtggcggacatcagtccggagatgcaggcagac gcgttagatattgccagcaaagccattaaagggcatcagctagagaaggatatggcggct cacatcaaacgcgagtttgacaagcgccactttccgacgtggcactgcatcgtgggccga aatttcggtgccgatgtcgagcacgagagcaaaaacttcatttacctatatgttggacag atgtcagtgctactgtggaagacggcgtag

DBGET integrated database retrieval system