Leptotrichia sp. oral taxon 212: AMK43_05445 Help Entry AMK43_05445       CDS       T04044                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism leo  Leptotrichia sp. oral taxon 212 Pathway leo01100   Metabolic pathways leo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:leo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMK43_05445    00074 Mycolic acid biosynthesis     AMK43_05445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMK43_05445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ALA95548 UniProt:  A0A0K2JAR4 LinkDB All DBs Position 1137059..1137283 Genome browser AA seq 74 aa AA seqDB search MLEKIKSIVADQLGVDEDQVTEDASFIDDLGADSLDTVELIMAFEEEFDVEIPDEDAQKI KTVKDVIEYIESKQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgctagaaaaaataaaatcaatagtagcagaccaattaggagtggatgaggatcaagta actgaagatgcatcatttattgatgatttaggggcagattctttagatacagtagaatta ataatggcttttgaagaagaatttgatgtggaaatacctgatgaagatgcacaaaaaatt aaaacagttaaagatgtaatagaatacattgaatcaaaacaataa

DBGET integrated database retrieval system