Leptolyngbya sp. PCC 7376: Lepto7376_4441 Help Entry Lepto7376_4441    CDS       T02361                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism lep  Leptolyngbya sp. PCC 7376 Pathway lep01100   Metabolic pathways lep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Lepto7376_4441    00074 Mycolic acid biosynthesis     Lepto7376_4441   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Lepto7376_4441 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Ribosomal_L12_N DUF5783 Motif Other DBs NCBI-ProteinID:  AFY40544 UniProt:  K9Q612 LinkDB All DBs Position complement(4969303..4969545) Genome browser AA seq 80 aa AA seqDB search MNQEIFDKIKGIIVEQLDVDEAAVTAEANFITDLEADSLDTVELIMAFEEEFDIDIPDDI AEKITTVGEAVTIIDSKKAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaaccaagaaatttttgacaaaatcaaaggtattatcgtcgagcaattagatgtcgat gaagccgcagtaaccgctgaggctaactttattaccgatttggaagcagactcccttgac acagtagaactcattatggcgttcgaagaagagtttgatattgacattcccgatgatatt gctgagaaaatcacgactgtcggtgaagcagtgacaattattgactctaaaaaagctagc taa

DBGET integrated database retrieval system