Leptolyngbya sp. 15MV: J4558_25600 Help Entry J4558_25600       CDS       T09999                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lepv  Leptolyngbya sp. 15MV Pathway lepv01100   Metabolic pathways lepv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lepv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J4558_25600    00074 Mycolic acid biosynthesis     J4558_25600   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J4558_25600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DnaT_2 DUF5783 Phi-29_GP16_7 Motif Other DBs NCBI-ProteinID:  QYU68170 LinkDB All DBs Position 4706796..4707035 Genome browser AA seq 79 aa AA seqDB search MSDTAEKVKKIVVEHLGVDEAKVTSEASFIDDLGADSLDTVELVMAFEEAFGVEIPDDAA EKITTVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgacaccgcggaaaaggtgaagaagatcgtcgtggagcacctcggcgtggatgag gcgaaggtcaccagcgaggcgtccttcatcgatgacctcggtgccgacagcctcgacacg gtcgagctggtcatggcgttcgaggaagcgttcggcgtggagattccggacgacgcggcc gagaagatcacgaccgtgaaggacgcgatcgactacatcgagaagcagaaggcggcctga

DBGET integrated database retrieval system