Leucoraja erinaceus (little skate): 129693746 Help Entry 129693746         CDS       T09122                                  Name (RefSeq) mitoregulin-like   KO K29035   mitoregulin Organism leri  Leucoraja erinaceus (little skate) Brite KEGG Orthology (KO) [BR:leri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:leri03029]     129693746 Mitochondrial biogenesis [BR:leri03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     129693746 SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom Motif Other DBs NCBI-GeneID:  129693746 NCBI-ProteinID:  XP_055486491 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search MGEVSERTLHLAVLLSFTSGLIVGWQANIMRRRFLDWRRRRLHSKLLETQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgggcgaggtgtcggagaggaccctacacctggccgtgctcctgtccttcacgtcgggt ctgatcgtgggctggcaggccaacatcatgcgccgccgcttcctggactggcggaggagg cggctccactctaagctgctggagacacagaaaaaactggacctggcttga

DBGET integrated database retrieval system